LL-37: Evidence, Mechanism, Dosing & Legal Status

LL-37 is the only member of the cathelicidin antimicrobial-peptide family found in humans — a 37-residue, cationic, amphipathic alpha-helical fragment cleaved from the precursor hCAP-18 and central to innate host defense.11 It is best understood as a multifunctional immune molecule rather than a "performance" peptide, and its growing popularity in wellness circles runs well ahead of its human proof. This monograph separates the two.

This article is informational and editorial content for research and educational purposes only. It is not medical advice, not a protocol to follow, and not a sourcing guide. LL-37 is not an FDA-approved drug; it is sold as a "research chemical not for human use" and remains effectively FDA-restricted through 2026. Dosing figures are reported strictly as seen in the published literature for completeness — not as recommendations. Consult a licensed clinician before any health decision.

What is LL-37 and how does it work?

LL-37 is encoded by the CAMP gene on chromosome 3p21.31, translated as the 18-kDa precursor hCAP-18, and named for its two N-terminal leucines plus 37 total residues (sequence LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES, about 4.5 kDa, net charge near +6 at physiological pH).124 The mature peptide is liberated from hCAP-18 by proteinase 3 in neutrophils and by kallikreins in skin, and it is also produced by macrophages, mast cells, NK cells and epithelial cells of skin, gut and airway.11

Its antimicrobial mechanism is physical membrane disruption. As a cationic amphipath, LL-37 binds preferentially to anionic microbial membranes by electrostatic attraction, then inserts into the hydrophobic lipid core and destabilizes the bilayer — killing Gram-positive and Gram-negative bacteria, fungi and some enveloped viruses at effective concentrations from roughly 1 micromolar.4 Its disruption mode actually switches with membrane lipid structure, forming pores in unsaturated bilayers versus helical fibrous nanofibre superstructures in saturated ones, and it is documented against S. aureus (including MRSA), E. coli and other pathogens while inhibiting biofilm formation.46

Beyond killing, LL-37 is a potent immune modulator with a genuinely double-edged profile. On the protective side it neutralizes LPS (endotoxin) by direct binding, is protective in septic animal models, and can inhibit LPS/ATP-induced macrophage pyroptosis.8 On the harmful side, when complexed with self-DNA or self-RNA from dying cells it converts host nucleic acid into a potent stimulus that activates plasmacytoid dendritic cells via TLR9 (driving type-I interferon) and myeloid dendritic cells via TLR7/8, and it is an established T-cell autoantigen in psoriasis, with implications in lupus and atherosclerosis.7 For wound repair, LL-37 promotes neovascularization and re-epithelialization through the formyl-peptide receptor FPR2, EGFR transactivation, and a COX-1-dependent PGE2 pathway that is inhibitable by aspirin in vivo.5

One reason systemic dosing is impractical is pharmacokinetics: native LL-37 is proteolytically fragile, with a human plasma half-life of roughly 90 to 120 minutes, cleared by renal filtration and serum proteases that cleave at leucine-leucine bonds, while wound-fluid proteases rapidly inactivate it in situ.143 Oral bioavailability is effectively nil. This is why development has focused on topical delivery and engineered protease-resistant analogs.11

What is the evidence by indication?

The only human controlled evidence is in topical wound healing; everything else is animal-model or mechanistic work. The table below grades each indication honestly.

The wound-healing data are the headline. In a first-in-man phase I/IIa randomized, double-blind, placebo-controlled trial, 34 patients with hard-to-heal venous leg ulcers received topical synthetic LL-37 at 0.5, 1.6 or 3.2 mg/mL twice weekly for four weeks after a placebo run-in. The healing-rate constants were roughly six-fold higher at 0.5 mg/mL (p=0.003) and three-fold higher at 1.6 mg/mL versus placebo, with mean ulcer-area reductions near 68% and 50% — but the highest dose (3.2 mg/mL) showed no benefit and more local reactions, an inverted dose-response consistent with LL-37's cytotoxicity at higher concentrations.1 A subsequent larger multicentric phase II trial reported improved healing in larger wounds with negative prognostic factors.2 Readers can confirm the registered trial record and outcomes through indexed databases such as PubMed.

The preclinical signals are mechanistically strong but unproven in humans. In an MRSA-infected full-thickness wound model in 80 mice, combined topical and intraperitoneal LL-37 (1 mg/kg each) cut wound S. aureus burden from about 7.8x10^7 to 6.9x10^2 CFU/g (p<0.001) — comparable to teicoplanin — while producing superior re-epithelialization, granulation and angiogenesis.3 LL-37 also drives neovascularization via FPR2 and COX-1/PGE2, and is required for wound angiogenesis in CRAMP-knockout mice.5 Immune and antiviral effects (LPS neutralization, anti-pyroptotic action, spike-protein binding) are documented only in cell and animal systems.815 Consumer gut, "leaky gut," chronic-Lyme and general-immune claims have no controlled human support and are graded D.13

What doses appear in the literature?

Reported strictly as information, not a protocol. The only human-tested route is topical: synthetic LL-37 at 0.5 to 1.6 mg/mL applied to the wound bed twice weekly, as used in the venous-leg-ulcer trials; the 3.2 mg/mL concentration was less effective and more irritating, an explicit example of an inverted dose-response.1 Preclinical animal work used roughly 1 mg/kg topical and/or intraperitoneal in the MRSA model, and even consecutive daily dosing could not sustain plasma levels given the 90-to-120-minute half-life.314 No validated subcutaneous or IV human protocol exists; gray-market vendors market injectable native LL-37, but there is no FDA-sanctioned systemic dose, no pharmaceutical quality assurance, and the peptide's rapid proteolysis plus cytotoxicity and immunogenicity concerns make such use unsupported.20 A lab-handling note: native LL-37 retained about 94% potency at 4 degrees Celsius in sterile water over 28 days but lost roughly 40% activity within 72 hours at room temperature.21

The functional-medicine framing. Because the validated lever on this pathway is endogenous cathelicidin, the literature on vitamin D as a CAMP-gene inducer — via a vitamin-D response element in the gene promoter — is more relevant to most readers than exogenous LL-37, and is addressable through ordinary nutritional repletion under clinician guidance.13

How safe is LL-37 and what is the FDA status in 2026?

In the human topical trials the two lower doses were well tolerated over a month with no systemic safety signals, while the highest dose produced more local reactions — reflecting LL-37's mammalian-cell cytotoxicity and a narrow therapeutic window.1 The headline safety concern is autoimmunity: LL-37 complexed with self-nucleic acid drives type-I interferon and is a T-cell autoantigen in psoriasis, implicated in cutaneous and systemic lupus and atherosclerosis, so amplifying it in an interferon-prone individual is theoretically capable of provoking or worsening autoimmune skin disease.7 A second concern is tumor promotion: LL-37/hCAP-18 is overexpressed in and promotes ovarian, breast and lung cancers, melanoma and skin squamous-cell carcinoma (it is, however, suppressive in gastric and colon cancer — the effect is tissue-dependent), making exogenous LL-37 a theoretical hazard in anyone with known or suspected hormonally or EGFR-responsive malignancy.910 Concurrent NSAIDs or aspirin could blunt the COX-1-dependent angiogenic effect, and pregnancy and lactation are precautionary contraindications.5

On regulation, LL-37 is not FDA-approved for any indication.20 It had been placed on the restricted 503A Category 2 bulk-substances list, citing limited human safety data, immunogenicity and manufacturing-impurity concerns. Following 2026 policy shifts it is being removed from Category 2 — but it was not moved to compoundable Category 1, and it is specifically queued for a dedicated Pharmacy Compounding Advisory Committee review before the end of February 2027, alongside peptides such as GHK-Cu and Melanotan II.1617 Because any committee recommendation must still pass formal notice-and-comment rulemaking, LL-37 is expected to remain effectively FDA-restricted throughout 2026 — neither approved nor legally compoundable — and is otherwise sold only as a research chemical of unverified purity.18 For athletes, LL-37 is not specifically named on the WADA Prohibited List, but the landscape is in flux and the annual list should be verified.19

Bottom line. LL-37 is a genuinely important innate-immune molecule with elegant mechanisms, but as a therapy the human evidence is narrow: only small, early-phase topical wound-healing RCTs (grade B) support efficacy, in venous leg ulcers, where more is worse. Every other touted use is preclinical (C) or anecdotal (D) and should be read as hyped, not proven. The short half-life, narrow cytotoxic window, immunogenicity, and serious autoimmune and oncologic concerns are real reasons for caution. The most defensible takeaway for a general reader is not to chase injectable research LL-37 but to support endogenous cathelicidin through vitamin-D sufficiency under clinician guidance, and to treat exogenous LL-37 as an investigational topical wound agent, nothing more. Regulatory facts here are current as of June 2026 and should be re-verified against the FDA PCAC calendar.